DPCstruct | MC62535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 660 ± 100 aa |
| Standard deviation of domain lengths | 100.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 69.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5NWS3 | 2-524 | QSQWSFAKTSPLMTSLLCKVCVVFSMEEVCSHLQQVLETLEVNWQNVLSCISTLLVYHTHTQACLKELLSRLLSSAFHSYDVEKMIT… |
| A0A4W5JT00 | 1-724 | MLEVVHHLHTQNILSLEYMLESKPCSLVKQQLNYGKGEKAAKQTELQNRHNNPYSLFLCLSFCLKRVQMFDASLCGVSVSPDALRRF… |
| A0A4W3J2L8 | 11-662 | None |
| A0A1W0A6Q2 | 11-640 | None |
| A0A7M7N5H7 | 15-855 | None |
| E9G9V2 | 14-555 | None |
| A0A834Q2Q5 | 92-606 | None |
| A0A6P6DLK3 | 8-706 | None |
| A0A0F8ATN1 | 83-883 | None |
| A0A2T7NJH6 | 8-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.