DPCstruct | MC62534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 158 ± 30 aa |
| Standard deviation of domain lengths | 29.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2QFQ4 | 1-117 | MGRALSVGLDLMGTGRSVLLDEDFQKDIKSLEAMAENQVNLLTPREKDHVKALLTWASGNWVEATNIWEDVLQSHPTDILALKLAHD… |
| A0A368FT99 | 7-180 | ENLRDLEGWRASGLTLTTPSNECAKLFDGALRQIVSWSDCDALGGLVKTLEDMKAADPKAVLPRAFRLGLEGLGTSTCTRINETLKT… |
| A0A0N5AHN0 | 1-117 | None |
| A0A2B4RFE8 | 4-205 | None |
| A0A5A8DXM3 | 7-132 | None |
| A0A0L0L4A7 | 16-156 | None |
| A0A4W2HGH5 | 1-175 | None |
| A0A7S2RM94 | 8-187 | None |
| A0A368FCR0 | 7-207 | None |
| A0A6S7H0S4 | 7-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.