DPCstruct | MC6253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 14.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H9DXH8 | 3-118 | WENFIEYESLIIQKQFAGEIRFGPTFFSLNSNPEIKELNNKIFGDWFYKHNSMIYLQQWNSTKNPDTNLIAIDIFTLQYKIVLENIK… |
| A0A6P1NQJ8 | 12-138 | EQWTFLTEMNSIKLFQKFEGEIRFGPGYFSVKSEPPFHEFDGKTFGDWFFHYKDGIFLQQWDSTKSADSKLLYLDTIHLTITELKTQ… |
| A0A239KMC0 | 1-101 | None |
| A0A0N0RQV6 | 18-139 | None |
| A0A1W2AD63 | 42-177 | None |
| U5C2N5 | 94-233 | None |
| A0A0A2MLK3 | 8-134 | None |
| A0A418PME4 | 45-184 | None |
| A8MHX8 | 1-105 | None |
| A0A418R7I2 | 43-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.