DPCstruct | MC62525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 158 ± 23 aa |
| Standard deviation of domain lengths | 22.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6MRT2 | 8-168 | KTMVEFGSKALLLGHQVGSLYKRELKEGNREKLEELQEKVDKHAEEKEAWKKEKKEWLEERKRLATWRVRCLDSKEKLKGRIADLEV… |
| A0A0L9TBI7 | 18-175 | EELATLQKNFEEEKSAWAKEKALKENTKQLKTWKTRCLDYEKKNQNKEKDMKNEIEALKKELTEEKEGRVRLEFDMVGLQKYIITKH… |
| A0A4D6M014 | 1-149 | None |
| A0A4D6M4L2 | 37-165 | None |
| A0A4D6M5L1 | 111-296 | None |
| A0A4D6M605 | 1-130 | None |
| A0A4D6MRB7 | 196-331 | None |
| A0A4D6MUL1 | 124-246 | None |
| A0A4D6LGS8 | 52-233 | None |
| A0A4D6LGL3 | 240-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.