DPCstruct | MC6252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7MX24 | 10-108 | RNNTNDIKSLRAKYKQALPSLTELFPEWSHNDLLFAMDECRGDLELAIARISEGHANQWGQVKSKKSKPKPATQPNPKRTNHKSTPT… |
| A0A1X2J2M3 | 1-122 | MPTHTGSSRRPPKNNNHTNNNNGNDFKTLKILYRQQLPTLRELFPGWSQEDLVAAIHEANGDLELTIGRIMEGHTNQWDQVKTKKSK… |
| A0A1X0RZ70 | 1-105 | None |
| I1BLN6 | 1-136 | None |
| A0A1Y2F6K3 | 13-127 | None |
| A0A1Y1Y5R4 | 1-114 | None |
| A0A397J5R3 | 1-122 | None |
| A0A194SAX1 | 5-120 | None |
| A0A164Q6R2 | 1-119 | None |
| A0A2W1EWQ5 | 14-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.