DPCstruct | MC62515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 497 ± 76 aa |
| Standard deviation of domain lengths | 75.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.19 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 91.39 |
| Assigned Pfam label(s) | PF12936- PF05178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DGH5 | 7-351 | KLGNLLGDGARDEQLSVSAKYAKKYNEKKDRIEAARAAQIFADEDVENTSEESTEDENANLLTQHVESKIFDTLTKIKAKDPSIYQS… |
| A0A7S0SUU7 | 22-545 | AEKFEKLQLKQELQRNKHILNEDNDFDESDSESESEDEDAQLLDTGLELKIVQTINMIRRKDPQIYDKKNQWFPSDSNDDDYDNEDI… |
| A0A2Z6M1U2 | 1-497 | None |
| A0A6G1NQ04 | 7-433 | None |
| A0A402FV26 | 40-581 | None |
| A0A5K4EZQ5 | 198-809 | None |
| A0A7S1T8L4 | 66-656 | None |
| A0A183LFK9 | 197-720 | None |
| S7RQV0 | 44-621 | None |
| A0A2H3C987 | 3-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.