DPCstruct | MC62514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 144 ± 33 aa |
| Standard deviation of domain lengths | 33.20 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0SU27 | 77-202 | TTTTPVVVEKVSLGPPPNDFGLKLDYYVDAQKLVNQMRYAVQLEKGDPIIASFAQKVKDDMTQFVSYYRRNNAVSGKQSFSLLYTSI… |
| A4S1S2 | 1-84 | MAPGTEGREESINTTRNMTNAWVAKYRRDNKTTGKPSYGQVYSALNAVSGHFNNFGTKYPFPAKRKDRVFAEFEQAELLLSRGR |
| A0A7J9KSL2 | 15-135 | None |
| A9TE51 | 1-152 | None |
| R1BZI2 | 179-302 | None |
| M8AER1 | 307-407 | None |
| A0A383WL66 | 27-193 | None |
| D8LJ72 | 65-206 | None |
| B5ILH8 | 23-143 | None |
| A0A1X9L2G6 | 7-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.