DPCstruct | MC62513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H4I194 | 86-217 | IRIIRFEEEGKTLEAYVKMLMLSKDQVTVLGLSIAGTLSACRSIHALMYSKNEFTITNYFTGESKTYKTNRAYRRDEEIHNKVCHTF… |
| A0A533S4M8 | 1-120 | MPLTISLEGKRASATLFASNLIYRRLRDIVFLTAYGPTQEVRAFGQLLTEEGTSLKVPEIITLRSVRCEGMYRIIPNLDNGYSAIYL… |
| Q4V1J6 | 23-155 | None |
| A0A419DFZ5 | 2-143 | None |
| A0A2V8X8X2 | 7-112 | None |
| A0A2V9LF79 | 1-141 | None |
| A0A6N9P4S2 | 1-127 | None |
| A0A3D1LFC5 | 8-147 | None |
| A0A268BT23 | 8-147 | None |
| A0A2V9LZS2 | 6-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.