DPCstruct | MC6251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 247 ± 56 aa |
| Standard deviation of domain lengths | 56.46 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 96.00 |
| Assigned Pfam label(s) | PF05859- CL0273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2IRY4 | 12-228 | RAYEDSEFVSELFGMLPIDLLDKLYNIHNIVFYRVLDGFRQFLIANTTMNASRKEHLLQKVLPRFETFVEVSIDRFFNIFQQYFLDN… |
| A0A402EMK0 | 33-229 | SEKVMLYETQFFGFTPQTCMMRMYFAFQDHLFHMMLVIEEVILKKLESMRYAKLTSSSIRRCSEKFLAYMRNHFDQLFGKMEQLLLQ… |
| A0A2H9TQ31 | 1-198 | None |
| A0A0D0T6Y6 | 12-267 | None |
| A0A0H2R4G0 | 2-273 | None |
| G1KVB7 | 6-184 | None |
| A0A1E4SSC9 | 7-274 | None |
| A0A162LF77 | 8-348 | None |
| A0A2G8RZB4 | 291-604 | None |
| G4T5M6 | 7-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.