DPCstruct | MC62505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 3.86 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 96.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19459 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5WL09 | 33-106 | QPAFYAYAYPEPDGYRDADLPAGARWDEELGEYLFPWDAVLAAVDPAGAVHTFLETTYGRAADAGDWDRAALER |
| A0A7X7HKW8 | 74-146 | AFYAYVYPEPEGYGASPVEPAAAWYHSGAREFILPYEAVRSAPDPDAVLLQFLESTYRAAADCGGWDRAALER |
| A0A7G1I4E1 | 174-242 | None |
| A0A535VTI1 | 135-209 | None |
| A0A7W1FFF9 | 44-118 | None |
| A0A1G8KYX5 | 228-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.