DPCstruct | MC6250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B6F2 | 62-200 | RSKHFVRTISSSLKCLKDVEEPKEVHEVKEKEAPKRSGAPMGQFIKPNLRQKRMLVWSKKYPSVAEVPEYVPVSKMVNATDIFRIKA… |
| A0A0L7RK98 | 8-108 | LCTLGTPSYNVSNFNKRILVWVKRYPSIDQVPSQLPIEVIQQAHTKARIRVCFIMMIFSILGLLISAQIGKRDVASGKNIYTERTKW… |
| A0A1W0XCR1 | 23-115 | None |
| A0A0C9SBA3 | 10-140 | None |
| A0A3B3QUY7 | 2-158 | None |
| A0A4Z2JEY4 | 8-124 | None |
| A0A7I8VA27 | 21-134 | None |
| E2BFR9 | 2-89 | None |
| A0A1Y1L502 | 30-124 | None |
| A0A084WEM3 | 469-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.