DPCstruct | MC625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 163 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251X7T3 | 49-206 | HYPESQSIQLPVFVEDEGKLTLAASRSSDEKNYLVDLHHLTCTCSDWQQRRANYPAADIRRICKHLYEKLYHQGLEADLPVTLRLAL… |
| A0A7V2IQ41 | 21-174 | ETIITVGNIDPKYDRLYKAASRSEQGKWYKVNVQRLTCSCPDWQKRRSAYPPGDVRRVCKHVYDKLYQTGVEKHFDDIVRLLIRYGR… |
| A0L3Z5 | 131-319 | None |
| A0A518G4I6 | 110-257 | None |
| T2G7M3 | 13-178 | None |
| A0A653MTD6 | 124-296 | None |
| A0A844GH25 | 37-207 | None |
| A0A3G9GB50 | 40-227 | None |
| A0A285SRX8 | 62-250 | None |
| A0A101VSQ3 | 37-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.