DPCstruct | MC62498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 147 ± 34 aa |
| Standard deviation of domain lengths | 34.49 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8M3J1 | 6-100 | AAFLHFTFSQLCQGPTSVMDYLTLCENHSCWLLDAVPPLGHAGPAAQQRFINLVDVLYEKQCRLVLVSECGLPELVAGVEREDIQRT… |
| A0A3P9M7I3 | 167-331 | FEELTLRQKTVTAPRVITVLGRRLTLQKTCGSVADCTFDELCGRPLGAVDYLEIARLFDTVFIRHVPTLTLSLKDQVRRFTTLIDNL… |
| A0A0C2IRC9 | 6-103 | None |
| A0A845S4A6 | 134-247 | None |
| A0A453DVK7 | 2-163 | None |
| K2SGK2 | 133-270 | None |
| W4GJS9 | 159-303 | None |
| A0A7S2BYN0 | 9-124 | None |
| A0A1I8FKM4 | 145-297 | None |
| A0A7R9UC94 | 45-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.