DPCstruct | MC62497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 312 ± 67 aa |
| Standard deviation of domain lengths | 67.24 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 73.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.46 |
| Pfam Score | 97.44 |
| Assigned Pfam label(s) | CL0023- CL0431- CL0060- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845S4A6 | 11-250 | NPLPKIVKTFKKDFDIIFFDEFQITNIADAMILGKLLEQFFSNNIFIITTSNVKPDDLYLGGLQRDQFLPYIENIKDNTLVYSLNSG… |
| A0A3P9M7I3 | 36-330 | QSLPQRRLGKMFTYDPISPVAMEIANETSLLCFDEFQVTDIADAMILKQLFGTLFKTGVVVVATSNRCPDDLYKNGLQRDTFLPFIH… |
| W7IL88 | 395-615 | None |
| C1E3X1 | 185-643 | None |
| A0A1I8FKM4 | 59-300 | None |
| W4GJS9 | 29-291 | None |
| A0A061DEF5 | 482-914 | None |
| A0A6P5FRZ5 | 274-479 | None |
| K2SGK2 | 6-265 | None |
| A0A7S1FKH8 | 66-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.