DPCstruct | MC6249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Standard deviation of domain lengths | 20.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532CGP0 | 2-148 | LHEAKAFATARDWPVREIDEREKTLNRVIDERNVDYIGPVFGIELQPHPNSEPLRLEFDKHLFVQQYCKTQFAGSGAHIEIIRFLRE… |
| A0A212JH80 | 1-167 | MGVTIHYEGKLKSANDFNDVIEIIQEFSEFNNMSYSVFEESKKLLKRVKDEQEWDYVSSVKGIRLQPHENTDPLIFEFDENYYIQDY… |
| A0A1V9GAJ8 | 1-191 | None |
| A0A353Z9H1 | 1-179 | None |
| A0A7C0YM60 | 1-175 | None |
| A0A842MKI9 | 1-186 | None |
| V7G9J5 | 38-206 | None |
| A0A0D6QI68 | 20-164 | None |
| A0A7I8DKV6 | 10-140 | None |
| A0A1D2U0Q3 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.