DPCstruct | MC62486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 340 ± 54 aa |
| Standard deviation of domain lengths | 53.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2JU99 | 18-426 | YQSVDESTAAATPPQDEKAMLSQQNTNPMFPETLARIMTIKTFPLKSDEKAPKLQRENILSLLYHADEQWVKSTLELNQSIKREEPS… |
| A0A075APQ3 | 1-333 | MTLQSSLSVIFRFKKWHPSSEQTIPSLNEAHPLSLFYFSDDHLVHACEELEKIRDVRSLKYQRALEKVHRAQRLVLNTFNLVYSEMD… |
| A0A0A9XAD5 | 14-330 | None |
| A0A671EMS5 | 11-293 | None |
| A0A507EST3 | 5-370 | None |
| A0A238C5T3 | 57-316 | None |
| A0A6P6Y1D5 | 50-469 | None |
| E0VTV8 | 10-301 | None |
| A0A0L0G3F0 | 30-432 | None |
| A0A146MEV2 | 14-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.