DPCstruct | MC62481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 189 ± 26 aa |
| Standard deviation of domain lengths | 26.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.31 |
| Pfam Score | 75.95 |
| Assigned Pfam label(s) | PF15005- PF15203- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2N838 | 1-194 | MGPRLSLLVGALASCLLPALGCVICDTKVVEALNSLETDYLPGHLGAEHHKNVMKRLKQAVQDFKELPIDEDSYMGVVDEATLEKAS… |
| C6ZEA8 | 1-182 | MGPWGLPLLVATLAGCLFPARGCVICDPKVREALNSLEADYLPGHLEANHQKKVMEKIKQAVEDFKDLPIDEDSYMGVVDEATLEKA… |
| A0A402FD69 | 16-211 | None |
| A0A6I9JZK7 | 175-385 | None |
| A0A6J0Y3R3 | 4-207 | None |
| A0A6J0U5T4 | 6-213 | None |
| A0A6J3I2B1 | 1-146 | None |
| A0A836D6T2 | 1-148 | None |
| A0A6J1XMY2 | 1-232 | None |
| A0A2Y9LU72 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.