DPCstruct | MC62480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 353 ± 79 aa |
| Standard deviation of domain lengths | 78.82 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836D322 | 25-419 | DIAQELLELPSLGELWALLQRPHGPGGPLEAVAEALCSARGPRKPGGPSLNWYEASDLKELVGQEPVQTLWDNSLSPTCTELMGALD… |
| A0A060Z5F4 | 21-352 | AMCNHGIMSLFGISKLPIMTETDPSTQQEHRMEELVNKFKIPRNATPFCMNFYLDMVNTTGGAIAWAFLKPMLLGQVLYSPDTPLTR… |
| G3IJC3 | 137-421 | None |
| W5MN10 | 25-357 | None |
| M3ZEM8 | 332-710 | None |
| A0A820W8L0 | 364-683 | None |
| A0A6S7H9G5 | 6-214 | None |
| A0A4U5NEW5 | 146-662 | None |
| A0A183TZE6 | 20-265 | None |
| A0A820C866 | 1-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.