DPCstruct | MC6248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14284 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212J9T9 | 1-58 | MILSACIDGKRIETIEVSISQLKVIQSRGICNKNTKYHNQIINLVEQNIPLIGERLVA |
| A0A1M5KM30 | 357-411 | MLSARISGELVETVEVNLRKMEVSQARGFKNKPTEHHKKIVDTVRENMDKIAKRA |
| A0A4Y8WME6 | 1-66 | None |
| A0A642MBM8 | 226-283 | None |
| A0A7W6HXB0 | 246-300 | None |
| A0A519P922 | 259-313 | None |
| K1UM62 | 168-221 | None |
| F0F822 | 300-354 | None |
| A0A8B2BGT5 | 509-565 | None |
| A0A1Y4U1B3 | 265-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.