DPCstruct | MC62477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 198 ± 52 aa |
| Standard deviation of domain lengths | 51.60 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836CQZ1 | 1-212 | MFAKGTKITHAVVIKKLNEILQARGKKRTDHAAQIEPLQLLVQITSENNLGEGIIIKIKFNITTSLYDYNPNLATYMKPEMWQKRMD… |
| A0A183WC48 | 55-181 | FEKGQEINFEVVVRRMEEILASRGKKGTSTSDQIVLLMQVEEKIKEYNLSRGLLAKLLFAFISILFDYDKKHDCMSASAFDRTINAF… |
| R1D1A7 | 501-739 | None |
| E2LUV5 | 212-432 | None |
| A0A1S3IUF1 | 254-383 | None |
| A0A835LHG0 | 54-284 | None |
| A0A6G1DGP9 | 158-328 | None |
| A0A7S3E5Z8 | 94-369 | None |
| A0A2R7VZW8 | 133-262 | None |
| A0A396JF28 | 27-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.