DPCstruct | MC62476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E4W1 | 2-73 | YLTTEGETYLVVKLDNPILQGQTRYDSMVFSLDKKDIEVSAKDKRLKDYYTGTQDEVVVEIFEKMLGVEARQ |
| A0A836CP57 | 1-106 | MAMSTNYKIPYTTVLRLFLLPHKDQHQLFFVISPDPPIKQGQTRYHFLILLFSKDEDISLMLNMNREEVEKPFEGQLTKNMSGSLYE… |
| A0A1J8Q694 | 244-354 | None |
| A0A7S4PAG4 | 225-344 | None |
| A0A7R9U489 | 114-210 | None |
| A0A067CAM1 | 93-216 | None |
| A0A7S4PGG1 | 135-231 | None |
| A0A1Z5SVF0 | 671-786 | None |
| A0A7J9E7Z8 | 129-225 | None |
| A0A3M7MCI9 | 272-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.