DPCstruct | MC62475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 3.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 46.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G3QVI3 | 15-72 | FGASETTGEVRKEFGRQLWREHPAEADVVIPVPDSSTFAALGYAQEAGLPFDYGLIRS |
| A0A2H5QUK5 | 34-99 | VVFGRSVYESRYHFGEVLATEAPVECDVVIAVPDSGVVAALEYAAKAGVPFQQGLIRSHYVGRTFI |
| A0A829GVM1 | 32-97 | None |
| A0A653CLT7 | 295-360 | None |
| A0A843FU53 | 5-69 | None |
| A0A7R9BJM0 | 334-391 | None |
| M7AZ82 | 221-288 | None |
| A0A0M3J566 | 100-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.