DPCstruct | MC62440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5VL03 | 17-69 | GLILDEVQVEGKSCCKSTIARNCYNVCRLRDLQPVCAQVCGCKIISGNECPSD |
| P01539 | 1-46 | KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTKCDSGWNH |
| D7L3I4 | 1-83 | None |
| R0GYM0 | 101-146 | None |
| A0A565B8Q1 | 1-90 | None |
| A0A565B7U0 | 1-86 | None |
| Q38L62 | 4-78 | None |
| M0W8Y0 | 5-64 | None |
| A0A287T4L4 | 34-89 | None |
| A0A4U6U3F4 | 7-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.