DPCstruct | MC62432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P1FDB6 | 11-97 | ETAWLEPSCSAWISLDGKIAVDRVLKLETLDTDFAALCEDLGTPLVPLPRTNQSEHAHYSTYYDDETRDIVARRYASDIESFGYRFE |
| F2AWN2 | 23-129 | TFEAFVMDFLSPQRLHQHPLFAPQTYFICNYRMEIQMDFVGKLESIDTDFSRVQESLPKPVESLQVQNTSRERLHDFREEYKSPAVI… |
| A7BUW7 | 2-75 | None |
| A0A5S3RGB1 | 22-116 | None |
| A0A6B3M7T7 | 1-107 | None |
| A0A6L8EKH2 | 2-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.