DPCstruct | MC62421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1HZY9 | 1-82 | MRTAERLARIIAAVGLAQNFSALKALATVGIQKGHMDLHAQNIAMMAGAVGEEIDKVARALVAKGTVRVDVAEQVLQELRRA |
| A0A842NJ08 | 15-92 | VAYAQELVCVMVASGLAQNYSAIRALSTEGIQKGHMRLHARNLATAAGATTDQIDTVVQKMIESKKISLDSAKEILQN |
| A0A7Z9ZP13 | 59-138 | None |
| A0A7V5ST76 | 40-120 | None |
| A0A7C2V644 | 123-203 | None |
| A0A832GZX1 | 4-72 | None |
| A0A496MDK8 | 59-137 | None |
| A0A832UJC7 | 31-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.