DPCstruct | MC62420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 469 |
|---|---|
| Mean domain length (aa) | 196 ± 31 aa |
| Standard deviation of domain lengths | 31.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.36 |
| Pfam Score | 96.84 |
| Assigned Pfam label(s) | PF03782- PF04885- PF06119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7CPB9 | 39-218 | TTLQQGASFNYCMDAGWQHMDSALILDDFFSDTVDIGFAFSFFGNSYTQCALSGNVFLSFNLSNTDNVSPFAWSNTNTIFHNAIFPA… |
| A0A0D8CPT4 | 15-236 | ATPIVSGLGGSAGFGENVLPANDDGSSGLIDITPALSGGLDFFGTNYSSLYVNNNGNVTFAERLGTFTPYALTGATDNPIIAPFFAD… |
| A0A814W5K5 | 134-337 | None |
| C3ZP85 | 206-373 | None |
| C3ZWM4 | 45-267 | None |
| A0A6S7GCA2 | 51-266 | None |
| A0A084R4M6 | 470-652 | None |
| A0A1Q7LN16 | 121-315 | None |
| A0A2E3DYV2 | 16-190 | None |
| B8ILY6 | 22-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.