DPCstruct | MC6242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 204 ± 35 aa |
| Standard deviation of domain lengths | 35.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4H6A9 | 110-350 | IANLGNSLAAVKKLVFDQGAIGQQELAKALAEDFDGLTHEQLRQRLINGAPKYGNDDDSVDELLARAYQTYIDELKQYHNPRYGRGP… |
| A0A1Q3N9A6 | 39-270 | ARIAAQADRYKRLREIALAQPRYGRGHSEVDKLGNQIIEMIATISVKTFTDPWPQFAQSLQNLTKRYSSENHPFGIQIQPGVGTFEN… |
| A0A2N0K851 | 22-200 | None |
| A0A376ST29 | 32-230 | None |
| A0A2V1JUV2 | 555-749 | None |
| A0A1V1PHJ0 | 868-1094 | None |
| T2RGR3 | 27-249 | None |
| A0A117LXC0 | 2-148 | None |
| A0A829K553 | 10-230 | None |
| A0A7V3DY23 | 547-779 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.