DPCstruct | MC62417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 409 ± 96 aa |
| Standard deviation of domain lengths | 96.04 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.87 |
| Pfam Score | 52.27 |
| Assigned Pfam label(s) | PF05090- PF12077- CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1J2X1 | 5-332 | IKNIPLFRYLVIACQAATIVVTFPLWQVRESPPLLPLIPLPTFDMGVILLVSLALILIRPREGLIAHTVLLVYSMLVDQTRIQPECV… |
| A0A2D9HDL3 | 2-439 | NCTDREVGVFLPVRHSVQVLIKAKVRAGFQQALRAGTLRRLALTRILVGGCLMLGLTLEDLQILTEFTAEVRRPSGLMKAFALTPLH… |
| U2HTZ3 | 169-449 | None |
| A0A2E5G114 | 22-441 | None |
| A0A2A3Z7T0 | 6-314 | None |
| A0A7W1ZUY2 | 10-320 | None |
| A0A7S1P1S8 | 37-639 | None |
| A0A2V6GQT9 | 78-524 | None |
| A0A2D5Z842 | 42-546 | None |
| A0A2E4HEW8 | 410-873 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.