DPCstruct | MC62412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 218 ± 37 aa |
| Standard deviation of domain lengths | 36.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WUT3 | 13-281 | SNPKLVFGSTQERKLLPTLPSAAPASRLGLLLHRDSWPQLGPGRYATEQRTSFTHQLDLRPRSRRGVMFGASTEPRLLKAERRRAPS… |
| A0A821CVD8 | 1-160 | MDLNIIPETKRAFKPFNAASVRFPIVARSTDVPGPGSYECDVKQNRQVHMLHSFGGRTKLIPAIKTKCMPLNRDKCVICLKQPIGDY… |
| A0A1B6CP27 | 31-273 | None |
| A0A1A9ZD62 | 40-283 | None |
| A0A1A9UMZ3 | 14-217 | None |
| A0A1D2N9P4 | 204-395 | None |
| A0A816X439 | 520-696 | None |
| A0A482WRQ5 | 34-292 | None |
| D2A2C0 | 1-217 | None |
| A0A1A9WFY2 | 130-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.