DPCstruct | MC6241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559J8V7 | 26-196 | WVGLQGGGTMIVRECEDDFTMITQHDHADLSAQFARQFKPEFYMDTEFTDDVLLAIREHDRGWIGLDEIPLWNDRIHAPFSFFDYPL… |
| A0A7Y5TYM7 | 1-149 | MTQPDHARLAADLLDQWTGIGDHPRRDALRLAAREHDNGWRELDEEIVFDGAAGRALDFIDAPDRVKQRVWPRGVDRLAAASAYAAA… |
| A0A7Z9Y110 | 1-167 | None |
| A0A4Q3EEI3 | 7-158 | None |
| A0A2V8J1L6 | 115-276 | None |
| A0A2P6WI31 | 96-255 | None |
| A0A5C8MEH0 | 1-171 | None |
| A0A518AU17 | 1-187 | None |
| A0A7K0R903 | 147-322 | None |
| M0LWU2 | 32-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.