DPCstruct | MC62409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 276 ± 51 aa |
| Standard deviation of domain lengths | 51.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.28 |
| Pfam Score | 86.80 |
| Assigned Pfam label(s) | CL0159- PF08337- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WQT9 | 48-282 | FAELQTDMSDLTSALEHGRVIIHEHKTYVLNVLFPGAPDHPVGKDTLPVGFTVGVKTAMAQFEQLLTNRNFLLMLLEALESQKTFSS… |
| A0A2U3Z8E6 | 2-242 | AELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSM… |
| A0A1S3QLA9 | 239-471 | None |
| A0A2G8LCG0 | 11-177 | None |
| A0A182DWZ0 | 125-294 | None |
| A0A2R7W2M5 | 2-233 | None |
| A0A402FNJ9 | 296-525 | None |
| A0A6P8GJP5 | 674-897 | None |
| S4RNR0 | 8-204 | None |
| A0A5J5CEK7 | 120-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.