DPCstruct | MC62407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 201 |
|---|---|
| Mean domain length (aa) | 120 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WN19 | 11-111 | AFAAVVVSSHVAKRQVPEEYPTYAQVPDDVAFTCDDKLPGYYADVDYQCQVWHWCTPQATLYSFLCPNQTVFNQQYRVCDWWYNVDC… |
| A0A1W0WKC1 | 374-491 | VWDALKALRGGRDQLKSNEIQDLLGKAVAGVDYPNLSVIPTSTFSCEAVKQAGFYADVDTKCQVIRRCDTNGVEYSYLCPNQTIFNQ… |
| A0A1W0X6L2 | 73-210 | None |
| A0A6P3DAW8 | 51-186 | None |
| A0A3L8DMZ6 | 32-184 | None |
| A0A162NUX5 | 12-111 | None |
| A0A162T605 | 19-129 | None |
| A0A482WUJ6 | 55-174 | None |
| A0A4C1ZWG6 | 51-179 | None |
| A0A1W0X3B8 | 3-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.