DPCstruct | MC62404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 162 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF00566- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WJ15 | 1-182 | MFDTPVGEDEPADSGSEGAGVEAHLRTRPLTEVYHLWRLAGGDLEAELRNQGRVKGKPPILTVPNVVTLEGETFGVRRDRDTLYDPS… |
| A0A653BXX2 | 10-165 | IFTISELYYWWQLTGGDVLQELKRQGLIRSSPPILSLPHLVLIEGTILGQDRNPATLYDPKIVEMPMETLYERFKNIPFACYYPLIQ… |
| A0A812AUH1 | 1-158 | None |
| A0A2A2L8P4 | 4-130 | None |
| A0A7R8ZLX5 | 3-169 | None |
| A0A238C104 | 143-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.