DPCstruct | MC62403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 381 ± 68 aa |
| Standard deviation of domain lengths | 68.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WGD0 | 5-403 | GGLEEIGIPGKEYLRKALTSCSDPLKAISDFQSLCDKLIQQINDIGKLDGRERDRKLRDLLHKSFPVIRFKTLRPIVMAILKHTREV… |
| A0A7M7RA91 | 37-435 | GILLPTLQPALPLLDLHMIQRFAFHHSIMEELREKLMSRAQELAKSDTKGRFKTIEDLLSKCFPLIRVKSIQPVVMSVMKCLPKIPE… |
| A0A818NAH6 | 146-463 | None |
| A0A2R5GIN9 | 50-347 | None |
| A0A1J1HRC1 | 10-387 | None |
| A0A5J4Y9H1 | 109-586 | None |
| A0A1J4JJ68 | 8-376 | None |
| A0A817G1X0 | 7-429 | None |
| A0A3B0JSC3 | 3-275 | None |
| C1E6S5 | 61-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.