DPCstruct | MC62400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A667IV31 | 12-83 | SGALAKPQMRGLLAKRLRFHIVGAFAVSLGVAAFYKFAVAEPRKKAYADFYRNYDSMKDFEEMKKAGIFQSA |
| A0A6A4WCN5 | 1-73 | MSLAKPQMRNLLQAAIKKNLAITAGVTTAAVAAYYFLVKAPRKQKYAEFYKNYDAEAEFERMRKLGLFQACSK |
| A0A6P4ZII8 | 28-110 | None |
| A0A5N4A096 | 14-95 | None |
| A0A813R0L0 | 1-78 | None |
| A0A834MMS0 | 16-102 | None |
| A0A060WX81 | 18-100 | None |
| A0A7R9E9A4 | 81-171 | None |
| A0A0L8IBK3 | 6-79 | None |
| A0A6P8ZP32 | 5-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.