DPCstruct | MC624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 93 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0UZH4 | 65-149 | QGGWPGEGNIDANPLFIDTDSGDYHLKSQAGHWESEGRLRWVEDNATSPCIDAGDPLSPAGDEPEPNGRRINMGAYGGTAEASKS |
| A0A1G3ALV0 | 217-300 | SGGFEGEGNIDADPLFADTDNGDYHLKSQTGRWDPAGGNWINDDLTSPCVDAGDPNSQVGEEPEPNGGRINMGAYGGTAEASKS |
| A0A660V3S5 | 626-715 | None |
| A0A0F8P5U4 | 409-491 | None |
| A0A2M8BE20 | 1-82 | None |
| A0A355C9C1 | 470-555 | None |
| A0A1V5ZM40 | 447-516 | None |
| A0A7X7TZD3 | 927-1054 | None |
| A0A7X7U3C1 | 1118-1220 | None |
| A0A3N5E694 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.