DPCstruct | MC62399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 165 ± 28 aa |
| Standard deviation of domain lengths | 28.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 16.67 |
| Assigned Pfam label(s) | PF13908- CL0547- PF07204 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813H711 | 392-522 | GCPHDQFYYDARCMSYCPMFYYEQKFNWRCGRCNENCEFCKNWGGCEDCRRDTTLQRYELRDDGTCEAFRIHPFKVYYDCAKLLAGS… |
| A0A834JWP2 | 44-191 | FSECKSNWYQYEDKCWQECPIGSYAITEESTTRKVCGRCHYSCLTCSGATDGECTTCHSDSNLLTNFGETQCVLQNLAWRFESTMWF… |
| A0A7G2C8S7 | 259-427 | None |
| A0A7G2CDG2 | 148-355 | None |
| A0A7G2CHS8 | 51-242 | None |
| A0A7G2CIU0 | 25-197 | None |
| A0A7G2CIY0 | 19-181 | None |
| A0A7G2CJV4 | 106-299 | None |
| A0A7G2CK25 | 248-383 | None |
| A0A058ZHS4 | 234-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.