DPCstruct | MC62395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 307 |
|---|---|
| Mean domain length (aa) | 103 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 99.44 |
| Assigned Pfam label(s) | CL0125- CL0144- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4W0P3 | 4-94 | CDHSEAVQPVPESGVNVSASCEDCGNMDENWVCLHCYKTLCGRFAKEHMLQHSSAAGHQVVLSAADLSTWCYGCDSYVDNDKTQAAK… |
| A0A453K3F3 | 1-59 | CLRCHHPSENWLCLICKDVLCSRFINKHMLYHYQETGHCIALSFSDLSVWCFACDSYLD |
| A0A6G0XKB9 | 16-137 | None |
| A0A7M5UR84 | 280-365 | None |
| A0A803J7U7 | 595-730 | None |
| F4PVY6 | 142-284 | None |
| F4PS83 | 5-117 | None |
| A0A2J8AFZ5 | 118-244 | None |
| A0A6U1B433 | 13-141 | None |
| L0DG64 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.