DPCstruct | MC62394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 178 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5LSX0 | 13-193 | ASLVGSAAGTLFSYNKAVFILDQTLRQWAVHQVQDMRIAQIGLYREDLRDLFGLTISRMDTYMTVNSVGLAVAVHSIYCGMIPPDIP… |
| A0A813J0B2 | 5-166 | ATFGVAAKELFDYNREMYQFDNTQRLDRELLRIEMQIKRFELFREDIRDLVELTVGKMEMYHVVGALVLESVVIFYTEGRMHTAAPP… |
| A0A812XE23 | 2-152 | None |
| A0A812R6L9 | 11-188 | None |
| A0A812MA01 | 2-157 | None |
| A0A813BEC5 | 7-158 | None |
| A0A812SY54 | 1-200 | None |
| A0A812JNU4 | 10-193 | None |
| C5L2C7 | 1-180 | None |
| A0A812XPQ1 | 3-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.