DPCstruct | MC62391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5LQ06 | 13-149 | RYKPTCRIGNWCEEVELNELRMKEYVSKKDSGDLLVISKQLMLERALQPSVAKFKGNDGILRNGDTVMLRNAATEGFLNANAEDLIP… |
| A0A7S3D0T8 | 53-167 | KGYYHSVRIGNWSEELELQESRLKDFLYRKEHGELALHKAERKLQQHLGPVELSKTEDGRVRFDSVALLFNHRTESVVATDLNDRTK… |
| A0A7E4S4Y4 | 217-346 | None |
| A0A1J1ICJ6 | 15-138 | None |
| A9VD38 | 2-114 | None |
| A0A811V9Z5 | 1-115 | None |
| A0A7J6UMT9 | 84-195 | None |
| A0A388LI50 | 1-175 | None |
| A0A5B8MYY9 | 13-145 | None |
| A0A5F5XXL3 | 18-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.