DPCstruct | MC6239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 231 ± 42 aa |
| Standard deviation of domain lengths | 42.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A254QVG1 | 356-570 | AGIVVVGRPLPRDTDLEPFCAAFAHEAPEGGYRSERVGVRMRDGSSRSARALRHESKSAERFRAAICDDELLQDIGRGRGINRTADN… |
| A0A1C3XUX2 | 40-273 | VTQQRPIRFMDGTERLLRCNGYDNADANLFSRAIAESGVLQALGRSRAVNRTAQNPVEALVILDDLTVPLPIDALVHVADVEPNEID… |
| A0A849NBB3 | 129-304 | None |
| A0A0F2KXD6 | 346-616 | None |
| V4Y502 | 809-1044 | None |
| A0A1U9LIT7 | 285-557 | None |
| A0A327K3P8 | 544-878 | None |
| A0A1Y5E8K1 | 284-522 | None |
| B7L3S7 | 260-525 | None |
| A0A5P9FBK4 | 302-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.