DPCstruct | MC62389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5LIL3 | 1-100 | MDITVTDATNVPDKAYLSIRVGETRRQAPLRLNEPLRFPSDSQESCKVDLFTQVGSSQVSLHQFREVGEQKQSVILHNLAGGPTVEL… |
| A0A813DMY8 | 1-101 | MELRVESADGHSLPNGAYVGVRVGDVLKQGRYEPQRCYHFPQVDRRRNAKIDIYQHVGSCVLAVDPDAKAVHEVTVTSTDPSFQPTK… |
| A0A7S1FCZ2 | 1-106 | None |
| A0A812HU04 | 1-99 | None |
| A0A813KJP1 | 1-105 | None |
| A0A812JKZ7 | 1-103 | None |
| A0A813DX55 | 1-106 | None |
| A0A0G4HC64 | 105-215 | None |
| A0A813FEM1 | 1-103 | None |
| A0A812RMB0 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.