DPCstruct | MC62384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2078 |
|---|---|
| Mean domain length (aa) | 136 ± 26 aa |
| Standard deviation of domain lengths | 25.70 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.47 |
| Pfam Score | 97.27 |
| Assigned Pfam label(s) | CL0276- CL0029- CL0063- CL0123- CL0373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5L2S7 | 13-143 | GGRHLSLDIFSDSRNKNALICHLAPLLQRVVKRPMDDKNGLIWKEGDIADQVVFVVRGQVGVEAPLENTQEETKGNAPRPPLWFYKE… |
| A0A3M3GGY6 | 82-157 | ELTVLKINIPANTALKWHSHPIPNAAYVASGEITVEKRDSNKEIRLKKGDALAEMVDIVHRGKTGDTPVELIVFYA |
| A0A520QNP0 | 90-224 | None |
| A0A356C141 | 4-100 | None |
| A0A4R6SVJ2 | 15-159 | None |
| A0A1M5R1Z6 | 41-140 | None |
| A0A819QKK7 | 399-499 | None |
| A0A521VTA1 | 1-101 | None |
| A0A7R9XRQ7 | 313-477 | None |
| X4ZMX5 | 134-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.