DPCstruct | MC62382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Standard deviation of domain lengths | 27.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5KZY8 | 3-153 | FQDLTRLDYIALIGPLVPYLWIIITPIASFILGCYLLVSLNVLGQHWTEAFSSLKIRDYKNFVRMHISPITGDLQCFVIGVDHVPTH… |
| A0A7J9HJP8 | 280-436 | AFDVPEVIAVTRSNICKYGIQSLSRGGAIIYYASVFLYFWVFSTPVVSLVFGSYLYICINWLHIHFDEAFSSLRIANYKSFTRFHIN… |
| A0A7J6UII6 | 152-335 | None |
| C5KZZ1 | 16-202 | None |
| A0A453BQL7 | 105-257 | None |
| A0A1F4PBB9 | 14-123 | None |
| A4HYN3 | 1242-1396 | None |
| A0A836KNT9 | 1050-1211 | None |
| A0A058ZUP4 | 307-468 | None |
| A0A6A3NHA8 | 235-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.