DPCstruct | MC6238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 131 ± 24 aa |
| Standard deviation of domain lengths | 24.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F2RKZ8 | 1-86 | MTLDELITTLDAADPTLVLPHGFTNPHSYRGYYEELAFEPATNVSVADMLADARSALGTTFTGWKGGEFTMRGYTDCWLAQEGSAG |
| A0A1C3X0C4 | 18-171 | EELSSAALLSSLEAHKDKSLIFNYDGRDVRPSYHVTEVKAGSFRSLDCGANPESWSETFIQLWDIDEENRRHMPAGKFLAIIRKVDE… |
| A0A5B8TFX0 | 57-170 | None |
| A0A285PCJ7 | 1-158 | None |
| A0A4P9K9I6 | 2-117 | None |
| A0A1Q9TXK8 | 4-89 | None |
| A0A172TAB7 | 1-150 | None |
| Q1MFA1 | 123-280 | None |
| A0A7Y3KMJ6 | 9-139 | None |
| A0A0F9SMX0 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.