DPCstruct | MC62376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 129 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S7PZ84 | 1-136 | MGRRGRTLFGDRWTVDLPSGCGEIADTVEHLVSSFPRELVCSECNAADGKAKLMMKGAIPAYFSFSPAEIRTFIEPVANADHRILEG… |
| A0A853YJJ7 | 107-236 | AKQRPAKVAGPEWRAALGEGGSRVMDTIRALVVRFDTALVCSECNAADGKAKTSVGTDPRFTFVATEIRQFVKATPHRDHEIDIEAA… |
| A0A7W6CM68 | 101-224 | None |
| A0A2A4UDD3 | 63-193 | None |
| A0A434NDH3 | 5-125 | None |
| A0A8A5XL59 | 94-226 | None |
| A0A508T801 | 108-242 | None |
| A0A2G3L9P7 | 26-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.