DPCstruct | MC62375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 130 ± 15 aa |
| Standard deviation of domain lengths | 15.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2RVC6 | 72-200 | LKKTGTGGQYNEFVYYDGEVIVSGKYQESRPGSLGGNLLCFYPDDETKHLIPRDVDLFGNPDVRKAWFCFDDQKEAKSSFGINDEEI… |
| A0A2N2DQV0 | 28-159 | ENKFDPTEVQVGDEVGGFRITELEVGNDGPNYSVVAWFEGRAILKGKFVQYEGHEFLGNATTFEVDEANSDRLPKLVYDDRYIWFAF… |
| A0A1B6B7I8 | 245-384 | None |
| A0A3N7FQZ0 | 89-203 | None |
| A0A352SZP7 | 8-117 | None |
| A0A352SZP6 | 145-279 | None |
| A0A2C6LGE4 | 1-91 | None |
| A0A4R3MNF3 | 70-228 | None |
| A0A7T5END3 | 67-213 | None |
| A0A644Y5A6 | 18-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.