DPCstruct | MC62372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 24 aa |
| Standard deviation of domain lengths | 24.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7QL66 | 1-148 | MNINHSVCSLAVTCLFFSITNTAQAATFTRFAEGLQNARGLTFGPDGELYVAEAGIGGGSTSSSSIPSPNIPGLDLYLGNTGAVSKV… |
| A0A7C2WHT3 | 421-524 | VASGLDNPRGLAFGPDGSLYVAEAGRGGESPCIAGPEGNEICYGLSGALTRVADGAQERVVTGLPSLAQADGGAALGPHDVAVRDDG… |
| A0A2D7PRL9 | 128-239 | None |
| A0A535ETV8 | 417-560 | None |
| A0A0P4V4E1 | 1-124 | None |
| A0A2N5K643 | 48-200 | None |
| A0A2T1CSP6 | 216-337 | None |
| A0A1I2CLJ2 | 3-128 | None |
| A0A7W0SFN1 | 3-98 | None |
| A0A1Z9XZS1 | 73-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.