DPCstruct | MC62370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 192 ± 33 aa |
| Standard deviation of domain lengths | 33.26 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7QA81 | 7-191 | LATIGFVTRNQFKEQQPDSLAISSEVNVQDNLKLAKILAEEASEMIKNPPHSLTVWQTSQDKWRKSIQLLEAVSDDTANSEEIEKRL… |
| A0A845Z342 | 9-159 | EEEANQKLIAAKKSAQLAETREVVAQFPESWKNVYSSWADALDKISSIPPQTTAYLEAKNLLPQYEQKLQLAEERRIVEQIGEEYYN… |
| A0A2I8ABZ2 | 234-416 | None |
| A0A1Z4JSF9 | 63-254 | None |
| L8M8T1 | 57-285 | None |
| A0A2K8WQ01 | 249-424 | None |
| A0A1Z4V674 | 182-395 | None |
| A0A1Z4V742 | 7-166 | None |
| A0A1Z4RNX9 | 251-439 | None |
| T2JHP9 | 141-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.