DPCstruct | MC6237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4TAJ3 | 1-95 | MTVVQKKHQFTTGPRKGETETRTAHRHADGFYRVYSPDGVVGSDGKRRWNVEENMKRLASIDEVADLVEKGWGVRMTGPLTPVPSLC… |
| A0A7S7Q7C6 | 3-83 | PRFERIGQDGERYVAHRFNDGRYRMANPALGRRKHHSANQLSVELTEIVGYLELGYLLRMRGETTKQVNLIAASEIRIIRD |
| A0A4Q3NJ83 | 1-83 | None |
| A0A8A6KCR3 | 313-385 | None |
| A0A0B8PUJ2 | 249-328 | None |
| A0A845ADD7 | 1-85 | None |
| A0A0F9M4H9 | 39-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.